ELISA Recombinant Rat FXYD domain-containing ion transport regulator 7(Fxyd7)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Rattus norvegicus (Rat) Uniprot NO.:P59649 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MATPTQSPTNVPEETDPFFYDYATVQTVGMTLATIMFVLGIIIIISKKVKCRKADSRSES PTCKSCKSELPSSAPGGGGV Protein Names:Recommended name: FXYD domain-containing ion transport regµLator 7 Gene Names:Name:Fxyd7 Expression Region:1-80 Sequence Info:FµLl length protein