Skip to Content

ELISA Recombinant Sheep Gap junction alpha-8 protein(GJA8)

https://www.anagnostics.com/web/image/product.template/156743/image_1920?unique=263afdf
(0 review)
Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Ovis aries (Sheep) Uniprot NO.:P55917 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:GDWSFLGNILEEVNEHSTVIGRVWLTVLFIFRILILGTAAEFVWGDEQSDFVCNTQQPGC ENVCYDEAFPISHIRLWVLQIIFVSTPSLVYVGHAVHHVRMEEKRKEREAEELSQQSPGN GGERAPLAADQGSVKKSSSSSKGTKKFRLEGTLLRTYVCHIIFKTLFEVGFIVGHYFLYG FRILPLYRCSRWPCPNVVDCFVSRPTEKTIFILFmLSVASVSLFLNILEMSHLGLKKIRS AFKRPVEQPLGEIPEKSLHSIAVSSIQKAKGYQLLEEEKIVSHYFPLTEVGMVEASPLSA KPFSQFEEKVGPGPLGDLSRAYQETLPSYAQVGAQEGVEEEQPIEAAAEPEVGDKSQEAE RVSTEGEETLAVLEEEKVEPPEVEKEAEKEETPPEKVSKQELTPEKAPSLCAELPGEDTR PLSRLSKASSRARSDDLTV Protein Names:Recommended name: Gap junction alpha-8 protein Alternative name(s): Connexin-49 Short name= Cx49 Lens fiber protein MP70 MP38 MP64 Gene Names:Name:GJA8 Expression Region:2-440 Sequence Info:FµLl length protein

1,798.00 € 1798.0 EUR 1,798.00 €

1,798.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days

Our Products !

Check out !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.