ELISA Recombinant Rat Gap junction beta-1 protein(Gjb1)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Rattus norvegicus (Rat) Uniprot NO.:P08033 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MNWTGLYTLLSGVNRHSTAIGRVWLSVIFIFRIMVLVVAAESVWGDEKSSFICNTLQPGC NSVCYDHFFPISHVRLWSLQLILVSTPALLVAMHVAHQQHIEKKmLRLEGHGDPLHLEEV KRHKVHISGTLWWTYVISVVFRLLFEAVFMYVFYLLYPGYAMVRLVKCEAFPCPNTVDCF VSRPTEKTVFTVFmLAASGICIILNVAEVVYLIIRACARRAQRRSNPPSRKGSGFGHRLS PEYKQNEINKLLSEQDGSLKDILRRSPGTGAGLAEKSDRCSAC Protein Names:Recommended name: Gap junction beta-1 protein Alternative name(s): Connexin-32 Short name= Cx32 GAP junction 28 kDa liver protein Gene Names:Name:Gjb1 Synonyms:Cxn-32 Expression Region:1-283 Sequence Info:FµLl length protein