ELISA Recombinant Xenopus laevis Gap junction beta-1 protein(gjb1)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Xenopus laevis (African clawed frog) Uniprot NO.:P08983 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MNWAGLYAILSGVNRHSTSIGRIWLSVVFIFRIMVLVAAAESVWGDEKSAFTCNTQQPGC NSVCYDHFFPISHIRLWALQLIIVSTPALLVAMHVAHLQHQEKKELRLSRHVKDQELAEV KKHKVKISGTLWWTYISSVFFRIIFEAAFMYIFYLIYPGYSMIRLLKCDAYPCPNTVDCF VSRPTEKTIFTVFmLVASGVCIVLNVAEVFFLIAQACTRRARRHRDSGSISKEHQQNEMN LLITGGSIIKRSAGQEKGDHCSTS Protein Names:Recommended name: Gap junction beta-1 protein Alternative name(s): Connexin-30 Short name= Cx30 Gene Names:Name:gjb1 Expression Region:1-264 Sequence Info:fµLl length protein