ELISA Recombinant Raja ocellata Gap junction delta-2 protein

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Raja ocellata (Skate) Uniprot NO.:P69999 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MGEWTILERLLEAAVQQHSTMIGRILLTVVVIFRILVVAIVGETVYDDEQTMFVCNTLQP GCNQACYDKAFPISHIRYWVFQIIMVCTPSLCFITYSVHQSSKQRERQYSTVFITLDKDK KREDNKIKNTTVNGVLQNSEFFTKEMQSDFLEVKEMQNSAARNSKMSKIRRQEGISRFYI IQVVFRNALEIGFLMGQYFLYGFKVPSMYECNRYPCVKMVECYVSRPTEKTVFLVFMFAV SGLCVILNLAELNHLGWRKIKTAVRGAQERRKSIYEIRNKDSPHRIGVPNFGRTQSSDSA YV Protein Names:Recommended name: Gap junction delta-2 protein Alternative name(s): Connexin-35 Short name= Cx35 Gap junction alpha-9 protein Gene Names: Expression Region:1-302 Sequence Info:fµLl length protein