Skip to Content

ELISA Recombinant Rat Glucagon-like peptide 2 receptor(Glp2r)

https://www.anagnostics.com/web/image/product.template/152338/image_1920?unique=5e1ca23
(0 review)
Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Rattus norvegicus (Rat) Uniprot NO.:Q9Z0W0 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MRPQPSPAVPSRCREAPVPRVRAQPVGIPEAQGPVPLHSQQMRLLWGPGRPFLALLLLVS IKQVTGSLLKETTQKWANYKEKCLEDLHNRLSGIFCNGTFDRYVCWPHSYPGNVSVPCPS YLPWWNAESPGRAYRHCLAQGTWQTRENTTDIWQDESECSENHSFRQNVDHYALLYTLQL MYTVGYSVSLISLFLALTLFLFLRKLHCTRNYIHMNLFASFILKVLAVLVKDMVSHNSYS KRPDDESGWMSYLSETSVSCRSVQVLLHYFVGTNHLWLLVEGLYLHTLLEPTVFPERRLW PKYLVVGWAFPmLFVIPWGFARAHLENTRCWATNGNLKIWWIIRGPmLLCVTVNFFIFLK ILKLLISKLKAHQMCFRDYKYRLAKSTLLLIPLLGVHEVLFTFFPDDQVQGFSKRIRLFI QLTLSSVHGFLVALQYGFANGEVKAELRKSWGRFLLARHWGCRTCVLGKNFRFLGKCSKK LSEGDGSETLQKLRFSTCSSHLASETLGDVGVQPHRGRGAWPRGSSLSESSEGDFTLANT MEEILEESEI Protein Names:Recommended name: Glucagon-like peptide 2 receptor Short name= GLP-2 receptor Short name= GLP-2-R Short name= GLP-2R Gene Names:Name:Glp2r Expression Region:1-550 Sequence Info:fµLl length protein

1,916.00 € 1916.0 EUR 1,916.00 €

1,916.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days

Our Products !

Check out !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.