ELISA Recombinant Xenopus tropicalis Germ cell-specific gene 1-like protein(gsg1l)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Xenopus tropicalis (Western clawed frog) (Silurana tropicalis) Uniprot NO.:A4IIV4 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MELSRRNRSLLSVVLNLLALSFSVAAFFTSYWCEGTHKVVKPPCLSAVKSKNCQALALNS SSTGSDATDTNGTLNPNVVHYNWETGDDKYAFKYFHTGFWFSCEKHQGEEACRSFIELSP DSEKGVLWLSVISEFLYIILLSLGFLLMCLEFFSSSNFIDGLKINAFAAIITVLSGLLGM VAHMMYMTVFQVTVNLGPKDWRPQTWYYGWSFGLAWLSFTLCMSASVLTLNTYTKTILEF KYRRRIFEKNVRECNPFLDPEMVRFLWEKYIFSVSSTVEDPFNWHKGFGSPIFVDIGSIT DLPGAVKEEERGMDLEDDGDQC Protein Names:Recommended name: Germ cell-specific gene 1-like protein Short name= GSG1-like protein Gene Names:Name:gsg1l Expression Region:1-322 Sequence Info:fµLl length protein