ELISA Recombinant Rat Proheparin-binding EGF-like growth factor(Hbegf)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Rattus norvegicus (Rat) Uniprot NO.:Q06175 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:ESLERLRRGLAAATSNPDPPTGTTNQLLPTGADRAQEVQDLEGTDLDLFKVAFSSKPQALATPGKEKNGKKKRKGKGLGKKRDPCLKKYKDYCIHGECRYLKELRIPSCHCLPGYHGQRCHGLTLPVENPLYTYDHTTVLAVVAVVLSSVCLLVIVGLLMFRYHRRGGYDLESEEKVKLGMASSH Protein Names:Recommended name: Proheparin-binding EGF-like growth factor Cleaved into the following chain: 1. Heparin-binding EGF-like growth factor Short name= 2. HB-EGF Short name= 3. HBEGF Gene Names:Name:Hbegf Synonyms:Dtr, Hegfl Expression Region:24-208 Sequence Info:fµLl length protein