Skip to Content

ELISA Recombinant Pongo pygmaeus Histamine H2 receptor(HRH2)

https://www.anagnostics.com/web/image/product.template/150197/image_1920?unique=41ec440
(0 review)
Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Pongo pygmaeus (Bornean orangutan) Uniprot NO.:P61752 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MAPNGTASSFCLDSTACKITITVVLAVLILITVAGNVVVCLAVGLNRRLRNLTNCFIVSL AITDLLLGLLVLPFSAIYQLSCKWSFGKVFCNIYTSLDVmLCTASILNLFMISLDRYCAV MDPLRYPVLVTPVRVAISLVLIWVISITLSFLSIHLGWNSRNETSKGNHTTSKCKVQVNE VYGLVDGLVTFYLPLLIMCITYYRIFKVARDQAKRINHISSWKAATIREHKATVTLAAVM GAFIICWFPYFTAFVYRGLRGDDAINEVLEAIVLWLGYANSALNPILYAALNRDFRTGYQ QLFCCRLANRNSHKTSLRSNASQLSRTQSREPRQQEEKPLKLQVWSGTEVTAPQGATDR Protein Names:Recommended name: Histamine H2 receptor Short name= H2R Short name= HH2R Alternative name(s): Gastric receptor I Gene Names:Name:HRH2 Expression Region:1-359 Sequence Info:fµLl length protein

1,714.00 € 1714.0 EUR 1,714.00 €

1,714.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days

Our Products !

Check out !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.