Skip to Content

ELISA Recombinant Takifugu rubripes 5-hydroxytryptamine receptor 1D(htr1d)

https://www.anagnostics.com/web/image/product.template/159722/image_1920?unique=b3f4f0f
(0 review)
Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Takifµgu rubripes (Japanese pufferfish) (Fµgu rubripes) Uniprot NO.:P79748 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MELDNNSLDYFSSNFTDIPSNTTVAHWTEATLLGLQISVSVVLAIVTLATmLSNAFVIAT IFLTRKLHTPANFLIGSLAVTDmLVSILVMPISIVYTVSKTWSLGQIVCDIWLSSDITFC TASILHLCVIALDRYWAITDALEYSKRRTMRRAAVMVAVVWVISISISMPPLFWRQAKAH EELKECMVNTDQISYTLYSTFGAFYVPTVLLIILYGRIYVAARSRIFKTPSYSGKRFTTA QLIQTSAGSSLCSLNSASNQEAHLHSGAGGEGGGSPLFVNSVKVKLADNVLERKRLCAAR ERKATKTLGIILGAFIICWLPFFVVTLVWAICKECSFDPLLFDVFTWLGYLNSLINPVIY TVFNDEFKQAFQKLIKFRR Protein Names:Recommended name: 5-hydroxytryptamine receptor 1D Short name= 5-HT-1D Short name= 5-HT1D Short name= 5HT1D Alternative name(s): F1D Serotonin receptor 1D Gene Names:Name:htr1d Expression Region:1-379 Sequence Info:fµLl length protein

1,735.00 € 1735.0 EUR 1,735.00 €

1,735.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days

Our Products !

Check out !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.