ELISA Recombinant Saccharomyces cerevisiae Protein-S-isoprenylcysteine O-methyltransferase(STE14)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) Uniprot NO.:P32584 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MHQDFQEDEHEYPDIRRNPLHEVTMTSYILGILLGIFVGLFPQIRFKNFNLFIIALSLFH FLEYYITAKYNPLKVHSESFLLNNGKSYMAAHSFAILECLVESFLFPDLKIFSYSLATKL CTVLGCLLVILGQYTRTIAMHTAGHSFSHIVKTKKESDHVLVKTGVYSWSRHPSYLGFFW WAIGTQLLLLNPLSLVIFIFVLWKFFSDRIRVEEKYLIEFFSAEYIEYKNKVGVGIPFI Protein Names:Recommended name: Protein-S-isoprenylcysteine O-methyltransferase EC= 2.1.1.100 Alternative name(s): Isoprenylcysteine carboxylmethyltransferase Prenylated protein carboxyl methyltransferase Short name= PPMT Prenylcysteine ca Gene Names:Name:STE14 Ordered Locus Names:YDR410C ORF Names:D9461.1 Expression Region:1-239 Sequence Info:fµLl length protein