Skip to Content

ELISA Recombinant Rabbit C-X-C chemokine receptor type 2(CXCR2)

https://www.anagnostics.com/web/image/product.template/151499/image_1920?unique=5e1ca23
(0 review)
Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Oryctolagus cunicµLus (Rabbit) Uniprot NO.:P35344 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MQEFTWENYSYEDFFGDFSNYSYSTDLPPTLLDSAPCRSESLETNSYVVLITYILVFLLS LLGNSLVmLVILYSRSTCSVTDVYLLNLAIADLLFATTLPIWAASKVHGWTFGTPLCKVV SLVKEVNFYSGILLLACISVDRYLAIVHATRTMIQKRHLVKFICLSMWGVSLILSLPILL FRNAIFPPNSSPVCYEDMGNSTAKWRMVLRILPQTFGFILPLLVmLFCYVFTLRTLFQAH MGQKHRAMRVIFAVVLIFLLCWLPYNLVLLTDTLMRTHVIQETCERRNDIDRALDATEIL GFLHSCLNPIIYAFIGQKFRYGLLKILAAHGLISKEFLAKESRPSFVASSSGNTSTTL Protein Names:Recommended name: C-X-C chemokine receptor type 2 Short name= CXC-R2 Short name= CXCR-2 Alternative name(s): GRO/MGSA receptor High affinity interleukin-8 receptor B Short name= IL-8R B CD_antigen= CD182 Gene Names:Name:CXCR2 Synonyms:IL8RB Expression Region:1-358 Sequence Info:fµLl length protein

1,713.00 € 1713.0 EUR 1,713.00 €

1,713.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days

Our Products !

Check out !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.