ELISA Recombinant Pongo abelii Integral membrane protein 2C(ITM2C)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Pongo abelii (Sumatran orangutan) Uniprot NO.:Q5NVC3 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MVKISFQPAVAGIKGDKADKASASAPAPASATEILLTPAREEQLPQHRSKRGSSVGGVCY LSMGMVVLLMGLVFASVYIYRYFFLAQLARDNFFRCGVLYEDSLSSQVRTQMELEEDVKI YLDENYERINVPVPQFGGGDPADIIHDFQRGLTAYHDISLDKCYVIELNTTIVLPPRNFW ELLMNVKRGTYLPQTYIIQEEMVVTEHVSDKEALGSFIYHLCNGKDTYRLRRRATRRRIN KRGAKNCNAIRHFENTFVVETLICGVV Protein Names:Recommended name: Integral membrane protein 2C Cleaved into the following chain: 1. CT-BRI3 Gene Names:Name:ITM2C Expression Region:1-267 Sequence Info:fµLl length protein