ELISA Recombinant Rat ATP-sensitive inward rectifier potassium channel 10(Kcnj10)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Rattus norvegicus (Rat) Uniprot NO.:P49655 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MTSVAKVYYSQTTQTESRPLVAPGIRRRRVLTKDGRSNVRMEHIADKRFLYLKDLWTTFI DMQWRYKLLLFSATFAGTWFLFGVVWYLVAVAHGDLLELGPPANHTPCVVQVHTLTGAFL FSLESQTTIGYGFRYISEECPLAIVLLIAQLVLTTILEIFITGTFLAKIARPKKRAETIR FSQHAVVAYHNGKLCLMIRVANMRKSLLIGCQVTGKLLQTHQTKEGENIRLNQVNVTFQV DTASDSPFLILPLTFYHVVDETSPLKDLPLRSGEGDFELVLILSGTVESTSATCQVRTSY LPEEILWGYEFTPAISLSASGKYVADFSLFDQVVKVASPGGLRDSTVRYGDPEKLKLEES LREQAEKEGSALSVRISNV Protein Names:Recommended name: ATP-sensitive inward rectifier potassium channel 10 Alternative name(s): ATP-sensitive inward rectifier potassium channel KAB-2 BIR10 Brain-specific inwardly rectifying K(+) channel 1 Short name= BIRK1 Inward r Gene Names:Name:Kcnj10 Synonyms:Kab-2 Expression Region:1-379 Sequence Info:FµLl length protein