ELISA Recombinant Rat Inward rectifier potassium channel 13(Kcnj13)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Rattus norvegicus (Rat) Uniprot NO.:O70617 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MDSRNCKVNAPLLSQRYRRMVTKDGHSTLQMDGAQRGLVYLRDAWGILMDMRWRWMmLVF SASFVVHWLVFAVLWYAVAEMNGDLEIDHDVPPENHTICVKHITSFTAAFSFSLETQLTI GYGTMFPSGDCPSAIALLAIQmLLGLmLEAFITGAFVAKIARPKNRAFSIRFTDLAVVAH KDGKPNLIFQVANTRPSPLTSVRVSAVLYQERENGELYQTSVDFHLDGISSEECPFFIFP LTYYHTITPSSPLATLLQHETPSHFELVVFLSAMQEGTGEICQRRTSYLPSEImLHHRFA ALMTRGSKGEYQVKMENFDKTVPEHPTPVVSKSPHRTDLDIHINGQSIDNFQIAETGLTE Protein Names:Recommended name: Inward rectifier potassium channel 13 Alternative name(s): Inward rectifier K(+) channel Kir7.1 Potassium channel, inwardly rectifying subfamily J member 13 Gene Names:Name:Kcnj13 Expression Region:1-360 Sequence Info:FµLl length protein