ELISA Recombinant Rat Potassium channel subfamily K member 3(Kcnk3)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Rattus norvegicus (Rat) Uniprot NO.:O54912 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MKRQNVRTLALIVCTFTYLLVGAAVFDALESEPEMIERQRLELRQLELRARYNLSEGGYE ELERVVLRLKPHKAGVQWRFAGSFYFAITVITTIGYGHAAPSTDGGKVFCMFYALLGIPL TLVMFQSLGERINTFVRYLLHRAKRGLGMRHAEVSMANMVLIGFVSCISTLCIGAAAFSY YERWTFFQAYYYCFITLTTIGFGDYVALQKDQALQTQPQYVAFSFVYILTGLTVIGAFLN LVVLRFMTMNAEDEKRDAEHRALLTHNGQAGGLGGLSCLSGSLGDGVRPRDPVTCAAAAG GMGVGVGVGGSGFRNVYAEmLHFQSMCSCLWYKSREKLQYSIPMIIPRDLSTSDTCVEHS HSSPGGGGRYSDTPSHPCLCSGTQRSAISSVSTGLHSLATFRGLMKRRSSV Protein Names:Recommended name: Potassium channel subfamily K member 3 Alternative name(s): Acid-sensitive potassium channel protein TASK-1 TWIK-related acid-sensitive K(+) channel 1 Two pore potassium channel KT3.1 Short name= Two pore K(+) chan Gene Names:Name:Kcnk3 Synonyms:Task, Task1 Expression Region:1-411 Sequence Info:FµLl length protein