ELISA Recombinant Sheep ligand(LG)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Ovis aries (Sheep) Uniprot NO.:P79368 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:QGICRNRVTDDVKDVTKLVANLPKDYMITLKYVPGMDVLPSHCWISEMVEQLSVSLTDLL DKFSNISEGLSNYSIIDKLVKIVDDLVECMEEHSFENVKKSSKSPEPRQFTPEKFFGIFN KSIDAFKDLEIVASTMSECVISSTSSPEKDSRVSVTKPFmLPPVAASSLRNDSSSSNRKA SNSIEDSSLQWAAVALPAFFSLVIGFAFGALYWKKKQPNLTRTVENRQINEEDNEISmLQ EK Protein Names:Recommended name: Kit ligand Alternative name(s): Mast cell growth factor Short name= MGF Stem cell factor Short name= SCF c-Kit ligand Cleaved into the following chain: 1. Soluble KIT ligand Short name= 2. sKITLG Gene Names:Name:KITLG Synonyms:SCF Expression Region:26-267 Sequence Info:fµLl length protein