ELISA Recombinant Rat NKG2-D type II integral membrane protein(Klrk1)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Rattus norvegicus (Rat) Uniprot NO.:O70215 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MSKCHNYDLKPAKWDTSQEHQKQRSALPTSRPGENGIIRRRSSIEELKISPLFVVRVLVAAMTIRFTVITLTWLAVFITLLCNKEVSVSSREGYCGPCPNDWICHRNNCYQFFNENKAWNQSQASCLSQNSSLLKIYSKEEQDFLKLVKSYHWMGLVQSPANGSWQWEDGSSLSPNELTLVKTPSGTCAVYGSSFKAYTEDCSNPNTYICMKRAV Protein Names:Recommended name: NKG2-D type II integral membrane protein Alternative name(s): Killer cell lectin-like receptor subfamily K member 1 NK cell receptor D NK lectin-like receptor Short name= NKLLR NKG2-D-activating NK receptor NKR-P2 CD_antigen= CD314 Gene Names:Name:Klrk1 Synonyms:Nkg2d, Nkrp2 Expression Region:1-215 Sequence Info:fµLl length protein