Skip to Content

ELISA Recombinant Rat Keratinocyte-associated protein 2(Krtcap2)

https://www.anagnostics.com/web/image/product.template/152453/image_1920?unique=5e1ca23
(0 review)
Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Rattus norvegicus (Rat) Uniprot NO.:B2RZC9 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MVVGTGTSLALSSLLSLLLFAGMQIYSRQLASTEWLTIQGGLLGSGLFVFSLTAFNNLEN LVFGKGFQAKIFPEILLCLLLALFASGLIHRVCVTTCFIFSMVGLYYINKISSTLYQATA PALTPAKVTGKSKKRN Protein Names:Recommended name: Keratinocyte-associated protein 2 Short name= KCP-2 Gene Names:Name:Krtcap2 Expression Region:1-136 Sequence Info:FµLl length protein

1,479.00 € 1479.0 EUR 1,479.00 €

1,479.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days

Our Products !

Check out !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.