ELISA Recombinant Rabbit Leukocyte cell-derived chemotaxin 1(LECT1)
Quantity:50 µg. Other Quantitys are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Oryctolagus cunicµLus (Rabbit)
Uniprot NO.:O77770
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:EVVRKTVPTTTKRPHSGPRGNPGPARMRNDSRPSVQEDSEPFNPDNPYHQEGESMTFDPR LDHEGICCIECRRSYTHCQKICEPLGGYNPWPYNYQGCRSACRVVMPCSWWVARILGMV
Protein Names:Recommended name: Leukocyte cell-derived chemotaxin 1 Cleaved into the following 2 chains: 1. Chondrosurfactant protein Short name= 2. CH-SP 3. ChondromodµLin-1 Alternative name(s): ChondromodµLin-I Short name= ChM-I
Gene Names:Name:LECT1 Synonyms:CHMI
Expression Region:215-333
Sequence Info:FµLl length protein
Our Products !
Check out !
Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.