ELISA Recombinant Takifugu rubripes Leptin receptor gene-related protein(leprot)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Takifµgu rubripes (Japanese pufferfish) (Fµgu rubripes) Uniprot NO.:B3Y064 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MAGIKALVGLSFSGAMGLTLLLLGCALEQYGIYWPLFVLIFYVLSPIPTFISRRLSDGGS SSNACRELAYFLTTGIVVSSFGLPIVLARTATIQWGACGLVMTGNAVIFLTIFGFFVVFG GGDEFSWEQW Protein Names:Recommended name: Leptin receptor gene-related protein Alternative name(s): OB-R gene-related protein Short name= OB-RGRP Gene Names:Name:leprot Synonyms:lepr-grp Expression Region:1-130 Sequence Info:fµLl length protein