ELISA Recombinant Rat Leukotriene C4 synthase(Ltc4s)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Rattus norvegicus (Rat) Uniprot NO.:Q925U2 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MKEETALLATVTLVGVLLQAYFSLQVISARRTFHVSPPLTSGPPEFERVFRAQVNCSEYF PLFLATLWVAGIFFHEGAAALCGLFYLFARLRYFQGYARSAQHRLDPLYASARALWLLVA MAALGLLVHFLPGTLRAALFRWLQVLLPMA Protein Names:Recommended name: Leukotriene C4 synthase Short name= LTC4 synthase EC= 4.4.1.20 Alternative name(s): Leukotriene-C(4) synthase Gene Names:Name:Ltc4s Expression Region:1-150 Sequence Info:fµLl length protein