ELISA Recombinant Sheep Melanocortin receptor 5(MC5R)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Ovis aries (Sheep) Uniprot NO.:P41983 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MNSSFHLHFLDLGLNATEGNLSGLSVRNASSPCEDMGIAVEVFLALGLISLLENILVIGA IVRNRNLHIPMYFFVGSLAVADmLVSLSNFWETITIYLLTNKHLVMADASVRHLDNVFDS MICISVVASMCSLLAIAVDRYVTIFCRLRYQRIMTGRRSGAIIAGIWAFCTSCGTVFIVY YESTYVVVCLIAMFLTmLLLMASLYTHMFLLARTHVRRIAALPGHSSVRQRTGVKGAITL AmLLGVFIICWAPFFLHLILMISCPQNLYCSCFMSHFNMYLILIMCNSVIDPLIYAFRSQ EMRKTFKEIVCFQGFRTPCRFPSTY Protein Names:Recommended name: Melanocortin receptor 5 Short name= MC5-R Gene Names:Name:MC5R Expression Region:1-325 Sequence Info:FµLl length protein