ELISA Recombinant Rat Microsomal glutathione S-transferase 1(Mgst1)
Quantity:50 µg. Other Quantitys are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Rattus norvegicus (Rat)
Uniprot NO.:P08011
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:ADLKQLMDNEVLMAFTSYATIILAKMMFLSSATAFQRLTNKVFANPEDCAGFGKGENAKK FLRTDEKVERVRRAHLNDLENIVPFLGIGLLYSLSGPDLSTALIHFRIFVGARIYHTIAY LTPLPQPNRGLAFFVGYGVTLSMAYRLLRSRLYL
Protein Names:Recommended name: Microsomal glutathione S-transferase 1 Short name= Microsomal GST-1 EC= 2.5.1.18 Alternative name(s): Microsomal GST-I
Gene Names:Name:Mgst1 Synonyms:Gst12
Expression Region:2-155
Sequence Info:FµLl length protein
Our Products !
Check out !
Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.