ELISA Recombinant Rat Lens fiber major intrinsic protein(Mip)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Rattus norvegicus (Rat) Uniprot NO.:P09011 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:ELRSASFWRAIFAEFFATLFYVFFGLGSSLRWAPGPLHVLQVALAFGLALATLVQTVGHI SGAHVNPAVTFAFLVGSQMSLLRAFCYIAAQLLGAVAGAAVLYSVTPPAVRGNLALNTLH AGVSVGQATTVEIFLTLQFVLCIFATYDERRNGRMGSVALAVGFSLTLGHLFGMYYTGAG MNPARSFAPAILTRNFSNHWVYWVGPIIGGGLGSLLYDFLLFPRLKSVSERLSILKGARP SDSNGQPEGTGEPVELKTQAL Protein Names:Recommended name: Lens fiber major intrinsic protein Alternative name(s): Aquaporin-0 MIP26 Short name= MP26 Gene Names:Name:Mip Expression Region:1-261 Sequence Info:fµLl length protein