ELISA Recombinant Rabbit Lens fiber major intrinsic protein(MIP)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Oryctolagus cunicµLus (Rabbit) Uniprot NO.:A4L9J0 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MWELRSASFWRAIFAEFFATLFYVFFGLGASLRWAPGPLHVLQVALAFGLALATLVQAVG HISGAHVNPAVTFAFLVGSQMSLLRAICYMAAQLLGAVAGAAVLYSVTPAAVRGNLALNT LHPGVSLGQATTVEIFLTLQFVLCIFATYDERRNGRLGSVALAVGFSLTLGHLFGMYYTG AGMNPARSFAPAILTRNFTNHWVYWVGPIIGGGLASLLYDFLLFPRLKSVSERLSILKGA RPSDSNGQPEGTGEPVELKTQAL Protein Names:Recommended name: Lens fiber major intrinsic protein Alternative name(s): Aquaporin-0 Gene Names:Name:MIP Expression Region:1-263 Sequence Info:FµLl length protein