ELISA Recombinant Streptococcus pneumoniae ATP synthase subunit a(atpB)
Quantity:50 µg. Other Quantitys are also available.
Product Type:Recombinant Protein
Species:Streptococcus pneumoniae (strain JJA)
Uniprot NO.:C1CF98
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MEESINPIISIGPVIFNLTmLAMTLLIVGVIFVFIYWASRNMTLKPKGKQNVLEYVYDFV IGFTEPNIGSRYMKDYSLFFLCLFLFMVIANNLGLMTKLQTIDGTNWWSSPTANLQYDLT LSFLVILLTHIESVRRRGFKKSIKSFMSPVFVIPMNILEEFTNFLSLALRIFGNIFAGEV MTSLLLLLSHQAIYWYPVAFGANLAWTAFSVFISCIQAYVFTLLTSVYLGNKINIEEE
Protein Names:Recommended name: ATP synthase subunit a Alternative name(s): ATP synthase F0 sector subunit a F-ATPase subunit 6
Gene Names:Name:atpB Ordered Locus Names:SPJ_1415
Expression Region:1-238
Sequence Info:fµLl length protein
Our Products !
Check out !
Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.