ELISA Recombinant Sheep ATP synthase subunit a(MT-ATP6)
Quantity:50 µg. Other Quantitys are also available.
Product Type:Recombinant Protein
Species:Ovis aries (Sheep)
Uniprot NO.:O78752
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MNENLFASFITPMMFGLPLVTLIVLFPSLLFPTSNRLVNNRLISLQQWmLQLVSKQMMSI HNTKGQTWALmLMSLILFIGSTNLLGLLPHSFTPTTQLSMNLGMAIPLWGGAVITGFRNK TKASLAHFLPQGTPTPLIPmLVIIETISLFIQPVALAVRLTANITAGHLLIHLIGGATLA LMSINTTTALITFIILILLTVLEFAVAMIQAYVFTLLVSLYLHDNT
Protein Names:Recommended name: ATP synthase subunit a Alternative name(s): F-ATPase protein 6
Gene Names:Name:MT-ATP6 Synonyms:ATP6, ATPASE6, MTATP6
Expression Region:1-226
Sequence Info:FµLl length protein
Our Products !
Check out !
Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.