ELISA Recombinant Vanderwaltozyma polyspora ATP synthase subunit a(ATP6)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) (Kluyveromyces polysporus) Uniprot NO.:A6H4Q8 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:SPLDQFEMNTLLKFVTPFFDMSNLNITTFGLYIIIVLMVIVSLNILTTNNNTIIGSRWNL PLEMIYDTILNTTKGQIGGKLWGLYFPLIYTLFMFILIANLISLIPYSFALTAQIVFVIS LSFIIWLGSTITGFNKHGWLFFSLFVPNGTPTPLVPLLVIIESLSYIARAFSLGLRLTCN ILAGHLLMVILGGLLLNFININKLTLILGIIPFAMILAILCLEFAIAMIQSYVFATLTAS YIKDSLYLH Protein Names:Recommended name: ATP synthase subunit a Alternative name(s): ATP synthase subunit 6 F-ATPase protein 6 Gene Names:Name:ATP6 ORF Names:VapofMp08 Expression Region:6-254 Sequence Info:fµLl length protein