ELISA Recombinant Xanthobacter autotrophicus ATP synthase subunit a(atpB)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2) Uniprot NO.:A7IGT0 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MTVDPIHQFEIKRYVDLLNFGGVQFSFTNAALFMFGIVAIIFFFLTFATRGRTLVPGRAQ SAAEMSYEFIAKMVRDSAGSEGMVFFPLVFSLFTFVLVSNVVGLIPYTFTVTAHLIVTAA MALLVIGTVIVYGFVRHGTHFLHLFVPSGVPAFLLPFLVVIEVVSFLSRPISLSLRLFAN mLAGHIALKVFAFFVVGLASAGVVGWFGATLPFFMIVALYALELLVAmLQAYVFAVLTSI YLNDAIHPGH Protein Names:Recommended name: ATP synthase subunit a Alternative name(s): ATP synthase F0 sector subunit a F-ATPase subunit 6 Gene Names:Name:atpB Ordered Locus Names:Xaut_1979 Expression Region:1-250 Sequence Info:fµLl length protein