ELISA Recombinant Rat ATP synthase protein 8(Mt-atp8)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Rattus norvegicus (Rat) Uniprot NO.:P11608 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MPQLDTSTWFITIISSMATLFILFQLKISSQTFPAPPSPKTMATEKTNNPWESKWTKIYLPLSLPPQ Protein Names:Recommended name: ATP synthase protein 8 Alternative name(s): A6L Chargerin II F-ATPase subunit 8 Gene Names:Name:Mt-atp8 Synonyms:Atp8, Atpase8, Mtatp8 Expression Region:1-67 Sequence Info:fµLl length protein