ELISA Recombinant Polypterus sp. Cytochrome c oxidase subunit 1(mt-co1)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Polypterus sp. (Bichir) Uniprot NO.:P29651 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:FWFFGHPEVYILILPGFGMISHIVAYYSGKNEPFGYMGMVWAMMAIGLLGFIVWAHHMYT VGMDVDTRAYFTSATMIIAIPTGVKVFSWLATLHGGAIKWETPmLWALGFIFLFTVGGLT GIILANSSLDImLHDTYYVVAHFHYVLSMGAVFAIMGGFVHWFPLFSGYTLHSTWTKIHF GVMF Protein Names:Recommended name: Cytochrome c oxidase subunit 1 EC= 1.9.3.1 Alternative name(s): Cytochrome c oxidase polypeptide I Gene Names:Name:mt-co1 Synonyms:coi, coxi, mtco1 Expression Region:1-184 Sequence Info:fµLl length protein