Skip to Content

ELISA Recombinant Scyliorhinus canicula Cytochrome c oxidase subunit 2(MT-CO2)

https://www.anagnostics.com/web/image/product.template/156628/image_1920?unique=263afdf
(0 review)
Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Scyliorhinus canicµLa (Small-spotted catshark) (Squalus canicµLa) Uniprot NO.:O79404 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MAHPSQLGFQDAASPVMEELIHFHDHTLMIVFLISTLVLYIITAMVSTKLTNKYILDSQE IEIVWTILPAIILIMIALPSLRILYLMDEINDPHLTIKAMGHQWYWSYEYTDYEDLGFDS YMIQTQDLTPGQFRLLETDHRMVVPMESPIRVLVSAEDVLHAWAVPALGVKMDAVPGRLN QTAFIISRPGVYYGQCSEICGANHSFMPIVVEAVPLEHFETWSSLmLEEA Protein Names:Recommended name: Cytochrome c oxidase subunit 2 EC= 1.9.3.1 Alternative name(s): Cytochrome c oxidase polypeptide II Gene Names:Name:MT-CO2 Synonyms:COII, COXII, MTCO2 Expression Region:1-230 Sequence Info:fµLl length protein

1,578.00 € 1578.0 EUR 1,578.00 €

1,578.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days

Our Products !

Check out !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.