ELISA Recombinant Xenopus laevis Cytochrome c oxidase subunit 2(mt-co2)
Quantity:50 µg. Other Quantitys are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Xenopus laevis (African clawed frog)
Uniprot NO.:P00407
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MAHPSQLGFQDAASPIMEELLHFHDHTLMAVFLISTLVLYIITIMMTTKLTNTNLMDAQE IEMVWTIMPAISLIMIALPSLRILYLMDEVNDPHLTIKAIGHQWYWSYEYTNYEDLSFDS YMIPTNDLTPGQFRLLEVDNRMVVPMESPTRLLVTAEDVLHSWAVPSLGVKTDAIPGRLH QTSFIATRPGVFYGQCSEICGANHSFMPIVVEAVPLTDFENWSSSmLEA
Protein Names:Recommended name: Cytochrome c oxidase subunit 2 EC= 1.9.3.1 Alternative name(s): Cytochrome c oxidase polypeptide II
Gene Names:Name:mt-co2 Synonyms:coii, coxii, mtco2
Expression Region:1-229
Sequence Info:fµLl length protein
Our Products !
Check out !
Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.