ELISA Recombinant Thermosynechococcus vulcanus Cytochrome c oxidase subunit 3(ctaE)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Thermosynechococcus vµLcanus (Synechococcus vµLcanus) Uniprot NO.:P50677 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MQGTVESQGTAIAVDHAHEHPDFRVLGLLVFLISESLMFGGLFAAYLLLRGMHEQWPPEG TEVELFVPTINTLILISSSFVIHYGDVAIKKDDVRGMRKWYWITAAMGAVFLGGQVYEYL TLGYGLRTNVFANCFYVMTGFHGLHVFIGILLILGVIWRSRRPGHYNAQKHTGVAMAEIY WHFVDVIWIILFTLLYILTRF Protein Names:Recommended name: Cytochrome c oxidase subunit 3 EC= 1.9.3.1 Alternative name(s): Cytochrome aa3 subunit 3 Cytochrome c oxidase polypeptide III Oxidase aa(3) subunit 3 Gene Names:Name:ctaE Expression Region:1-201 Sequence Info:fµLl length protein