Skip to Content

ELISA Recombinant Tragelaphus oryx Cytochrome c oxidase subunit 3(MT-CO3)

https://www.anagnostics.com/web/image/product.template/160085/image_1920?unique=b3f4f0f
(0 review)
Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Tragelaphus oryx (Eland) (Taurotragus oryx) Uniprot NO.:O47686 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MTHQTHAYHMVNPSPWPLTGALSALLMTFGLIMWFHFNSTALLmLGLTTNmLTMYQWWRD IIRESTFQGHHTPVVQKGLRYGMILFIISEVLFFTGFFWAFYHSSLAPTPELGGCWPPTG IHPLNPLEVPLLNTSVLLASGVSITWAHHSLMEGHRNHmLQALFITIALGVYFTLLQASE YYEAPFTISDGVYGSTFFVATGFHGLHVIIGSTFLIVCFFRQLKFHFTSSHHFGFEAAAW YWHFVDVVWLFLYVSIYWWGS Protein Names:Recommended name: Cytochrome c oxidase subunit 3 Alternative name(s): Cytochrome c oxidase polypeptide III Gene Names:Name:MT-CO3 Synonyms:COIII, COXIII, MTCO3 Expression Region:1-261 Sequence Info:fµLl length protein

1,610.00 € 1610.0 EUR 1,610.00 €

1,610.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days

Our Products !

Check out !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.