ELISA Recombinant Tragelaphus spekii Cytochrome c oxidase subunit 3(MT-CO3)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Tragelaphus spekii (Sitatunga) Uniprot NO.:O47688 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MTHQTHAYHMVNPSPWPLTGALSALLMTSGLTMWFHFNSMILLmLGLTTNmLTMYQWWRD IIRESTFQGHHTPVVQKGLRYGMILFIISEVLFFTGFFWAFYHSSLAPTPELGGCWPPTG IHPLDPLEVPLLNTSVLLASGVSITWAHHSLMEGHRNHmLQALFITIALGVYFTLLQASE YYEAPFTISDGVYGSTFFVATGFHGLHVIIGTTFLIVCFFRQLKFHFTSSHHFGFEAAAW YWHFVDVVWLFLYVSIYWWGS Protein Names:Recommended name: Cytochrome c oxidase subunit 3 Alternative name(s): Cytochrome c oxidase polypeptide III Gene Names:Name:MT-CO3 Synonyms:COIII, COXIII, MTCO3 Expression Region:1-261 Sequence Info:fµLl length protein