ELISA Recombinant Vanderwaltozyma polyspora Cytochrome c oxidase subunit 3(COX3)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) (Kluyveromyces polysporus) Uniprot NO.:A6H4Q3 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:mLNYMERSKHQQFPFHLVNPSPWPIVVSFSLLSLALSLGLTMHGYIGEMYLVNLALLVVL GSGVLWFRDIIAEATYLGDHTAAVRKGINIGFLLFVLSEVLIFSALFWSYFHSAMSPDVT LGACWPPVGITAVQPTELPLLNTIILLASGATVTYSHHALIQGNRKNSLSGLLITTWLII IFVICQYIEYTNATFTISDGVYGSVFFAGTGLHFLHMVmLAImLAVCYWRLRNYHLTNSH HVGYETTIIYLHVLDVIWLFLYIVFYWWGV Protein Names:Recommended name: Cytochrome c oxidase subunit 3 EC= 1.9.3.1 Alternative name(s): Cytochrome c oxidase polypeptide III Cytochrome oxidase subunit 3 Gene Names:Name:COX3 ORF Names:VapofMp03 Expression Region:1-270 Sequence Info:fµLl length protein