ELISA Recombinant Pomatostomus superciliosus Cytochrome b(MT-CYB)
Quantity:50 µg. Other Quantitys are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Pomatostomus superciliosus (White-browed babbler)
Uniprot NO.:P16362
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:TALLLAAHYTADTSLAFASVTHMCRNVQFGWLIRNLHANGASFFFICIYLHIGRGLYYGS YLNKETWNIGVILLLTLMA
Protein Names:Recommended name: Cytochrome b Alternative name(s): Complex III subunit 3 Complex III subunit III Cytochrome b-c1 complex subunit 3 Ubiquinol-cytochrome-c reductase complex cytochrome b subunit
Gene Names:Name:MT-CYB Synonyms:COB, CYTB, MTCYB
Expression Region:1-79
Sequence Info:fµLl length protein
Our Products !
Check out !
Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.