ELISA Recombinant Zaglossus bruijni NADH-ubiquinone oxidoreductase chain 1(MT-ND1)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Zaglossus bruijni (Long-beaked echidna) Uniprot NO.:O78713 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:ILLAVAFLTLIERKILGYMQFRKGPNIVGPHGLLQPIADAVKLFIKEPLRPMTSSIYMFI LAPILALSLALTIWVPLPMPLPLIDLNLGLLFVLSVSGLSVYSILWSGWASNSKYALTGA LRAVAQTISYEVTLAIILLSImLINGSFTLTTLNLTQEFMWLVVPTWPLmLTRFISTLAE TNRAPFDLTEGESELVSGFNVEYAAGPFAMFFLAEYANIIIMNALTVILFFGAYHLIFLP ELSTINFMIKTMmLTSLFLWIRASYPRFRYDQLMHLLWKNFLPITLVTCLWFImLPLALS WIP Protein Names:Recommended name: NADH-ubiquinone oxidoreductase chain 1 EC= 1.6.5.3 Alternative name(s): NADH dehydrogenase subunit 1 Gene Names:Name:MT-ND1 Synonyms:MTND1, NADH1, ND1 Expression Region:1-303 Sequence Info:fµLl length protein