ELISA Recombinant Protobothrops flavoviridis NADH-ubiquinone oxidoreductase chain 4(MT-ND4)
Quantity:50 µg. Other Quantitys are also available.
Product Type:Recombinant Protein
Species:Protobothrops flavoviridis (Habu) (Trimeresurus flavoviridis)
Uniprot NO.:P92794
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:PIAGSMVLAAILLKLGGYGIIRMMQVLPPTKTDMFLPFIVLALWGAILANLTCLQQTDLK SLIAYSSISHMGLVVAAIIIQTPWGLSGAMALMIAHGFTSSALFCLANTTYERTHTRILI LTRGFHNILPMTTTWWLLTNLMNIATPPSLNFTSELLIMSSLFNWCPTTIILLGLSmLIT ASYSLHMFLSTQTGPTLLDNQTEPTHSREHLLMALHIIPLMMISMKPELII
Protein Names:Recommended name: NADH-ubiquinone oxidoreductase chain 4 EC= 1.6.5.3 Alternative name(s): NADH dehydrogenase subunit 4
Gene Names:Name:MT-ND4 Synonyms:MTND4, NADH4, ND4
Expression Region:1-231
Sequence Info:fµLl length protein
Our Products !
Check out !
Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.