ELISA Recombinant Pongo abelii NADH-ubiquinone oxidoreductase chain 6(MT-ND6)
Quantity:50 µg. Other Quantitys are also available.
Product Type:Recombinant Protein
Species:Pongo abelii (Sumatran orangutan)
Uniprot NO.:P92700
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MTYALFLLSVILVMGFVGFSSKPSPIYGGLVLIISGAVGCAVILNCGGGYMGLMVFLIYL GGMMVVFGYTTAMAIEEYPEAWGSGVEVLVSVLVGLVMEVGLVLWVKEYDGVVVVVNFNS VGSWMIYEGEGSGLIREDPIGAGALYDYGRWLVVVTGWTLFVGVYVVIEIARGN
Protein Names:Recommended name: NADH-ubiquinone oxidoreductase chain 6 EC= 1.6.5.3 Alternative name(s): NADH dehydrogenase subunit 6
Gene Names:Name:MT-ND6 Synonyms:MTND6, NADH6, ND6
Expression Region:1-174
Sequence Info:fµLl length protein
Our Products !
Check out !
Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.