Skip to Content

ELISA Recombinant Sheep NADH-ubiquinone oxidoreductase chain 6(MT-ND6)

https://www.anagnostics.com/web/image/product.template/156774/image_1920?unique=263afdf
(0 review)
Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Ovis aries (Sheep) Uniprot NO.:O78757 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MMTYIVFILSIIFVMGFVGFSSKPSPIYGGLGLIVSGGVGCGIVLNFGGSFLGLMVFLIY LGGMMVVFGYTTAMATEQYPEVWVSNKVVLGTFITGLLMEFLMVYYVLKDKEVEIVFKFN GMGDWVIYDTGDSGFFSEEAMGIAALYSYGTWLVIVTGWSLLIGVVVIMEITRGN Protein Names:Recommended name: NADH-ubiquinone oxidoreductase chain 6 EC= 1.6.5.3 Alternative name(s): NADH dehydrogenase subunit 6 Gene Names:Name:MT-ND6 Synonyms:MTND6, NADH6, ND6 Expression Region:1-175 Sequence Info:FµLl length protein

1,520.00 € 1520.0 EUR 1,520.00 €

1,520.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days

Our Products !

Check out !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.