ELISA Recombinant Xenopus laevis NADH-ubiquinone oxidoreductase chain 6(mt-nd6)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Xenopus laevis (African clawed frog) Uniprot NO.:P03927 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MIYMVSVSMMVLVLGLVAVASNPSPFYAALGLVLAAGAGCLVIVSFGSSFLSIVLFLIYL GGmLVVFAYSAARAKPYPEAWGSWSVVFYVLVYLIGVLVWYLFLGGVEVDGMNKSSELGS YVMRGDWVGVALMYSCWWVIIVYWWVSIIINFVCGIWVNSKSMWWESSCV Protein Names:Recommended name: NADH-ubiquinone oxidoreductase chain 6 EC= 1.6.5.3 Alternative name(s): NADH dehydrogenase subunit 6 Gene Names:Name:mt-nd6 Synonyms:mtnd6, nadh6, nd6 Expression Region:1-170 Sequence Info:fµLl length protein