ELISA Recombinant Xenopus tropicalis N-acetylaspartate synthetase(nat8l)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Xenopus tropicalis (Western clawed frog) (Silurana tropicalis) Uniprot NO.:A4II32 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MTYRGTRKSPCCSPPPRCGPPLPSGPAGSALGPPSSGAEEEMTKEQVYLREFQPADQEFA RRIFYEGIKERILSSAFRGLKYQPLLQSVYAVIIIMCFVVTKSLLVTCCMPLFLLGMRYY YSRKIILNHLECALRTDMSDIEQYYMKQPGSCFWVAVLEGKVVGIVAARGNEEDNVVELR RMSVDSNYRGKGIAKALGRKVLEFAmLNHYSSIVLGTTAVKIAAHKLYESLGFKHVGVVE HHIVPGMTHSLLERLFFQLRYHRYCLQLREE Protein Names:Recommended name: N-acetylaspartate synthetase Short name= NAA synthetase EC= 2.3.1.17 Alternative name(s): N-acetyltransferase 8-like protein Gene Names:Name:nat8l Expression Region:1-271 Sequence Info:fµLl length protein