ELISA Recombinant Pongo abelii NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4(NDUFB4)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Pongo abelii (Sumatran orangutan) Uniprot NO.:P0CB72 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:SFPKYKPSRLSPLPETLDPAEYNISPETRRAQAERLAIRAQLKREYLLQYNDPNRRGLIE NPALLRWAYARTTNVYPNFRPTPKNSLMGALYGFGPLIFIYYIIKTERDRKEKLIQEGKL DRTFHLSY Protein Names:Recommended name: NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4 Alternative name(s): Complex I-B15 Short name= CI-B15 NADH-ubiquinone oxidoreductase B15 subunit Gene Names:Name:NDUFB4 Expression Region:2-129 Sequence Info:fµLl length protein