ELISA Recombinant Pongo pygmaeus NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6(NDUFB6)
Quantity:50 µg. Other Quantitys are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Pongo pygmaeus (Bornean orangutan)
Uniprot NO.:P0CB94
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:TGYTPDEKLRLQQLRELRRRWLKDQELSPREPVLPPQKMGPMEKFWNKFLENKSPWRKMV HGVYQKSIFVFTHVLVPVWIIHYYMKYHVSEKPYGIVEKKSRIFPGDTILETGEVIPPMK EFPDQHH
Protein Names:Recommended name: NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6 Alternative name(s): Complex I-B17 Short name= CI-B17 NADH-ubiquinone oxidoreductase B17 subunit
Gene Names:Name:NDUFB6
Expression Region:2-128
Sequence Info:fµLl length protein
Our Products !
Check out !
Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.