Skip to Content

ELISA Recombinant Pongo pygmaeus NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6(NDUFB6)

https://www.anagnostics.com/web/image/product.template/150209/image_1920?unique=41ec440
(0 review)
Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Pongo pygmaeus (Bornean orangutan) Uniprot NO.:P0CB94 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:TGYTPDEKLRLQQLRELRRRWLKDQELSPREPVLPPQKMGPMEKFWNKFLENKSPWRKMV HGVYQKSIFVFTHVLVPVWIIHYYMKYHVSEKPYGIVEKKSRIFPGDTILETGEVIPPMK EFPDQHH Protein Names:Recommended name: NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6 Alternative name(s): Complex I-B17 Short name= CI-B17 NADH-ubiquinone oxidoreductase B17 subunit Gene Names:Name:NDUFB6 Expression Region:2-128 Sequence Info:fµLl length protein

1,469.00 € 1469.0 EUR 1,469.00 €

1,469.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days

Our Products !

Check out !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.