Skip to Content

ELISA Recombinant Rat Neuropeptide Y receptor type 1(Npy1r)

https://www.anagnostics.com/web/image/product.template/152653/image_1920?unique=e16ca1f
(0 review)
Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Rattus norvegicus (Rat) Uniprot NO.:P21555 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MNSTLFSRVENYSVHYNVSENSPFLAFENDDCHLPLAVIFTLALAYGAVIILGVSGNLAL IIIILKQKEMRNVTNILIVNLSFSDLLVAVMCLPFTFVYTLMDHWVFGETMCKLNPFVQC VSITVSIFSLVLIAVERHQLIINPRGWRPNNRHAYIGITVIWVLAVASSLPFVIYQILTD EPFQNVSLAAFKDKYVCFDKFPSDSHRLSYTTLLLVLQYFGPLCFIFICYFKIYIRLKRR NNMMDKIRDSKYRSSETKRINVmLLSIVVAFAVCWLPLTIFNTVFDWNHQIIATCNHNLL FLLCHLTAMISTCVNPIFYGFLNKNFQRDLQFFFNFCDFRSRDDDYETIAMSTMHTDVSK TSLKQASPVAFKKISMNDNEKI Protein Names:Recommended name: Neuropeptide Y receptor type 1 Short name= NPY1-R Alternative name(s): FC5 Gene Names:Name:Npy1r Expression Region:1-382 Sequence Info:FµLl length protein

1,738.00 € 1738.0 EUR 1,738.00 €

1,738.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days

Our Products !

Check out !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.