ELISA Recombinant Xenopus laevis Neuropeptide Y receptor type 1(npy1r)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Xenopus laevis (African clawed frog) Uniprot NO.:P34992 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MNFSTYFENLSVPNNISGNITFPISEDCALPLPMIFTLALAYGAVIILGLSGNLALIIII LKQKEMRNVTNILIVNLSFSDLLATIMCLPFTLIYTLMDHWIFGEVMCKLNEYIQCVSVT VSIFSLVLIAIERHQLIINPRGWRPNNRHACFGITVIWGFAMACSTPLMMYSVLTDEPFK NISLDSYIGKYVCLEDFPEDKFRLSYTTLLFILQYLGPLCFIFVCYTKIFLRLKRRNNMM DKIRDNKYRSSETKRINImLLSIVVGFALCWLPFFIFNLVFDWNHEAVATCNHNLLFLIC HLTAMISTCVNPIFYGFLNKNFQRDLQFFFNFCDFRSREDDYETIAMSTMHTDVSKTSLK QASPIA Protein Names:Recommended name: Neuropeptide Y receptor type 1 Short name= NPY1-R Gene Names:Name:npy1r Expression Region:1-366 Sequence Info:fµLl length protein