ELISA Recombinant Sheep Neuropeptide Y receptor type 2(NPY2R)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Ovis aries (Sheep) Uniprot NO.:P79211 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:KMGPVLCHLVPYAQGLAVQVSTITLTVIALDRHRCIVYHLESKISKQISFLIIGLAWGVS ALLASPLAIFREYSLIEIIPDFEIVACTEKWPGEEKGIYGTVYSLLSLLILYVLPLGIIS FSYARIWSKLKNHVSPGAAHDHYHQR Protein Names:Recommended name: Neuropeptide Y receptor type 2 Short name= NPY2-R Alternative name(s): NPY-Y2 receptor Short name= Y2 receptor Gene Names:Name:NPY2R Expression Region:1-146 Sequence Info:FµLl length protein